PDB entry 4d6z

View 4d6z on RCSB PDB site
Description: Cytochrome P450 3A4 bound to imidazole and an inhibitor
Class: oxidoreductase
Keywords: oxidoreductase, monooxygenase, cytochrome p450, human cyp3a4, imidazole, inhibitory complex
Deposited on 2014-11-19, released 2015-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-25, with a file datestamp of 2016-05-20.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 3a4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4d6za_
  • Heterogens: HEM, PK9, IMD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4d6zA (A:)
    maylygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqp
    vlaitdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsg
    klkemvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpq
    dpfventkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesr
    ledtqkhrvdflqlmidsqnsaetashkalsdlelvaqsiififagyettssvlsfimye
    lathpdvqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkd
    veingmfipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgpr
    ncigmrfalmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrdgtv
    sgahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d6zA (A:)
    shglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdpd
    miktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvpi
    iaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfventk
    kllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledtqkhr
    vdflqlmidsqalsdlelvaqsiififagyettssvlsfimyelathpdvqqklqeeida
    vlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgvvvmip
    syalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnmklali
    rvlqnfsfkpcketqiplklslggllqpekpvvlkvesrd