PDB entry 4d6x

View 4d6x on RCSB PDB site
Description: Crystal structure of the receiver domain of NtrX from Brucella abortus
Class: signaling protein
Keywords: signaling protein, brucellosis, two-component system, response regulator, rec domain, microaerobisis
Deposited on 2014-11-18, released 2015-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-07, with a file datestamp of 2015-10-02.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterial regulatory, fis family protein
    Species: BRUCELLA ABORTUS [TaxId:235]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4d6xa_
  • Chain 'B':
    Compound: bacterial regulatory, fis family protein
    Species: BRUCELLA ABORTUS [TaxId:235]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4d6xb_
  • Chain 'C':
    Compound: bacterial regulatory, fis family protein
    Species: BRUCELLA ABORTUS [TaxId:235]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4d6xc_
  • Chain 'D':
    Compound: bacterial regulatory, fis family protein
    Species: BRUCELLA ABORTUS [TaxId:235]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4d6xd_
  • Heterogens: IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4d6xA (A:)
    masmtggqqmgrgsmaadilvvddevdirdlvagilsdeghetrtafdadsalaaindra
    prlvfldiwlqgsrldglalldeikkqhpelpvvmisghgnietavsairrgaydfiekp
    fkadrlilvaeraletsklklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d6xA (A:)
    dilvvddevdirdlvagilsdeghetrtafdadsalaaindraprlvfldiwlqgsrldg
    lalldeikkqhpelpvvmisghgnietavsairrgaydfiekpfkadrlilvaeralets
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4d6xB (B:)
    masmtggqqmgrgsmaadilvvddevdirdlvagilsdeghetrtafdadsalaaindra
    prlvfldiwlqgsrldglalldeikkqhpelpvvmisghgnietavsairrgaydfiekp
    fkadrlilvaeraletsklklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d6xB (B:)
    dilvvddevdirdlvagilsdeghetrtafdadsalaaindraprlvfldiwlqgsrldg
    lalldeikkqhpelpvvmisghgnietavsairrgaydfiekpfkadrlilvaeralets
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4d6xC (C:)
    masmtggqqmgrgsmaadilvvddevdirdlvagilsdeghetrtafdadsalaaindra
    prlvfldiwlqgsrldglalldeikkqhpelpvvmisghgnietavsairrgaydfiekp
    fkadrlilvaeraletsklklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d6xC (C:)
    dilvvddevdirdlvagilsdeghetrtafdadsalaaindraprlvfldiwlqgsrldg
    lalldeikkqhpelpvvmisghgnietavsairrgaydfiekpfkadrlilvaeralet
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4d6xD (D:)
    masmtggqqmgrgsmaadilvvddevdirdlvagilsdeghetrtafdadsalaaindra
    prlvfldiwlqgsrldglalldeikkqhpelpvvmisghgnietavsairrgaydfiekp
    fkadrlilvaeraletsklklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d6xD (D:)
    dilvvddevdirdlvagilsdeghetrtafdadsalaaindraprlvfldiwlqgsrldg
    lalldeikkqhpelpvvmisghgnietavsairrgaydfiekpfkadrlilvaeralet