PDB entry 4d5c

View 4d5c on RCSB PDB site
Description: tetracycline repressor class J, apo form
Class: transcription
Keywords: transcription, induction, allostery
Deposited on 2014-11-03, released 2016-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-20, with a file datestamp of 2016-01-15.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracycline repressor protein tetr
    Species: Proteus mirabilis [TaxId:584]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4d5ca1, d4d5ca2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4d5cA (A:)
    akldkeqvidnalillnevgmeglttrklaqklgveqptlywhvknkralldalaetilq
    khhhhvlplaneswqdflrnnaksfrqallmyrdggkihagtrpsanqfetseqqlqflc
    dagftltqavyalssiahftlgsvletqehqesqkerekvpkteinypplltqaidimds
    dngeaaflfvldvmisgletvlnnhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d5cA (A:)
    akldkeqvidnalillnevgmeglttrklaqklgveqptlywhvknkralldalaetilq
    khhhhvlplaneswqdflrnnaksfrqallmyrdggkihagtrpsanqfetseqqlqflc
    dagftltqavyalssiahftlgsvletqehqesqinypplltqaidimdsdngeaaflfv
    ldvmisgletvlnn