PDB entry 4d0n

View 4d0n on RCSB PDB site
Description: AKAP13 (AKAP-Lbc) RhoGEF domain in complex with RhoA
Class: cell cycle
Keywords: cell cycle, akap13, lbc, akap-lbc, gef, rhogef, dh domain, ph domain
Deposited on 2014-04-29, released 2014-05-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-05-21, with a file datestamp of 2014-05-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.21098
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transforming protein rhoa
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4d0na_
  • Chain 'B':
    Compound: A-kinase anchor protein 13
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12802 (2-End)
      • expression tag (0-1)
  • Heterogens: GDP, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4d0nA (A:)
smaairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwd
tagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkk
dlrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraal
qarrg

    Sequence, based on observed residues (ATOM records): (download) 
    >4d0nA (A:)
airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa

  • Chain 'B':
    No sequence available.