PDB entry 4d0f

View 4d0f on RCSB PDB site
Description: Human Notch1 EGF domains 11-13 mutant T466A
Class: transcription
Keywords: transcription, metal-binding, transmembrane, developmental, protein, notch signaling pathway, differentiation, phosphorylation, egf-like domain, regulation, receptor, activator, ank repeat, signalling, glycoprotein, extracellular, jagged, nucleus, membrane
Deposited on 2014-04-25, released 2014-05-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-06-04, with a file datestamp of 2014-05-30.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2247
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurogenic locus notch homolog protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46531 (2-117)
      • expression tag (1)
      • expression tag (118-125)
      • engineered mutation (57)
    Domains in SCOPe 2.04: d4d0fa1, d4d0fa2, d4d0fa3
  • Heterogens: CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4d0fA (A:)
    saqdvdecslganpcehagkcintlgsfecqclqgytgprceidvnecvsnpcqndaacl
    dqigefqcicmpgyegvhcevntdecasspclhngrcldkinefqcecptgftghlcqvd
    lhhildaqkmvwnhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d0fA (A:)
    aqdvdecslganpcehagkcintlgsfecqclqgytgprceidvnecvsnpcqndaacld
    qigefqcicmpgyegvhcevntdecasspclhngrcldkinefqcecptgftghlcqvdl
    hhild