PDB entry 4czn

View 4czn on RCSB PDB site
Description: Crystal structure of the extralong fungal manganese peroxidase from Ceriporiopsis subvermispora
Class: oxidoreductase
Keywords: class II (fungal) peroxidases, protoporphyrin ix, electron transfer, lignin peroxidase, lignin degradation, manganese peroxidase, mnii oxidation, peroxidase, oxidoreductase, hydrogen peroxide, metal-binding, secreted
Deposited on 2014-04-21, released 2014-12-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.1353
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: extralong manganese peroxidase
    Species: CERIPORIOPSIS SUBVERMISPORA [TaxId:42742]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CZN
    Domains in SCOPe 2.05: d4czna_
  • Heterogens: CA, NA, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cznA (A:)
    maptavcsdgtrvsnavccdfvslgqdlqsmvlqgdcgedaheiirltfhdavaisrklg
    psagggadgsmllfplvepefaasngiddsvnnlipflslhptisagdlvqfagavalsn
    cpgaprvqflagrpnhtiaaidglipepqdnvtsilerfddaggftpfevvsllashtia
    radkvdptldaapfdttpftfdsqiflevllkgvgfpgldnntgevssplplgdtstggk
    dtglmrlqsdfalahdprtacfwqgfvdqqefmsqsfasafaklavlghntddlidcsev
    vpvpkpavdkpttfpattgpqdlelsclaerfptlsvdpgaqetliphcsdglenctsvq
    fsgpatdsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cznA (A:)
    ptavcsdgtrvsnavccdfvslgqdlqsmvlqgdcgedaheiirltfhdavaisrklgps
    agggadgsmllfplvepefaasngiddsvnnlipflslhptisagdlvqfagavalsncp
    gaprvqflagrpnhtiaaidglipepqdnvtsilerfddaggftpfevvsllashtiara
    dkvdptldaapfdttpftfdsqiflevllkgvgfpgldnntgevssplplgdtstggkdt
    glmrlqsdfalahdprtacfwqgfvdqqefmsqsfasafaklavlghntddlidcsevvp
    vpkpavdkpttfpattgpqdlelsclaerfptlsvdpgaqetliphcsdglenctsvqfs
    gpatds