PDB entry 4cyw

View 4cyw on RCSB PDB site
Description: Structure of the A_mallard_Sweden_51_2002 H10 Avian Haemmaglutinin in complex with human receptor analog 6-SLN
Class: viral protein
Keywords: viral protein
Deposited on 2014-04-15, released 2014-06-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-30, with a file datestamp of 2014-07-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.21067
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/MALLARD/SWEDEN/51/2002 (H10N2)) [TaxId:757360]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cywa_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/MALLARD/SWEDEN/51/2002 (H10N2)) [TaxId:757360]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cywb_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/MALLARD/SWEDEN/51/2002 (H10N2)) [TaxId:757360]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cywc_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/MALLARD/SWEDEN/51/2002 (H10N2)) [TaxId:757360]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cywd_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/MALLARD/SWEDEN/51/2002 (H10N2)) [TaxId:757360]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cywe_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/MALLARD/SWEDEN/51/2002 (H10N2)) [TaxId:757360]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cywf_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cywA (A:)
    ldkiclghhavangtivktltneqeevtnatetvestsldrlcmkgrshkdlgnchpigm
    ligtpacdlhltgtwdtlierenaiaycypgatvneealrqkimesggiskistgftygs
    sinsagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
    stqekndlygtqslsisvgsstyqsnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
    hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
    kyvnkkslmlatgmrnvpeivqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cywA (A:)
    dkiclghhavangtivktltneqeevtnatetvestsldrlcmkgrshkdlgnchpigml
    igtpacdlhltgtwdtlierenaiaycypgatvneealrqkimesggiskistgftygss
    insagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss
    tqekndlygtqslsisvgsstyqsnfvpvvgarpqvngqsgridfhwtlvqpgdnitfsh
    nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
    yvnkkslmlatgmrnvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cywB (B:)
    glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrliektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlni
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cywB (B:)
    glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrliektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4cywC (C:)
    ldkiclghhavangtivktltneqeevtnatetvestsldrlcmkgrshkdlgnchpigm
    ligtpacdlhltgtwdtlierenaiaycypgatvneealrqkimesggiskistgftygs
    sinsagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
    stqekndlygtqslsisvgsstyqsnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
    hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
    kyvnkkslmlatgmrnvpeivqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cywC (C:)
    ldkiclghhavangtivktltneqeevtnatetvestsldrlcmkgrshkdlgnchpigm
    ligtpacdlhltgtwdtlierenaiaycypgatvneealrqkimesggiskistgftygs
    sinsagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
    stqekndlygtqslsisvgsstyqsnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
    hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
    kyvnkkslmlatgmrnvpe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cywD (D:)
    glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrliektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlni
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4cywE (E:)
    ldkiclghhavangtivktltneqeevtnatetvestsldrlcmkgrshkdlgnchpigm
    ligtpacdlhltgtwdtlierenaiaycypgatvneealrqkimesggiskistgftygs
    sinsagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
    stqekndlygtqslsisvgsstyqsnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
    hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
    kyvnkkslmlatgmrnvpeivqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cywE (E:)
    ldkiclghhavangtivktltneqeevtnatetvestsldrlcmkgrshkdlgnchpigm
    ligtpacdlhltgtwdtlierenaiaycypgatvneealrqkimesggiskistgftygs
    sinsagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
    stqekndlygtqslsisvgsstyqsnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
    hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
    kyvnkkslmlatgmrnvpe
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cywF (F:)
    glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrliektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlni