PDB entry 4cyb

View 4cyb on RCSB PDB site
Description: DpsC from Streptomyces coelicolor
Class: iron binding protein
Keywords: iron binding protein, dps, ferritin
Deposited on 2014-04-10, released 2014-06-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.16088
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative DNA protection protein
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: putative DNA protection protein
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4cybb_
  • Chain 'C':
    Compound: putative DNA protection protein
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: putative DNA protection protein
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: putative DNA protection protein
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: putative DNA protection protein
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: putative DNA protection protein
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: putative DNA protection protein
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: putative DNA protection protein
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: putative DNA protection protein
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: putative DNA protection protein
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: putative DNA protection protein
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cybB (B:)
    rtiqefgtvkqfpvaltmdtrlyscqrlnkvladtrilhdlykkyhwlmrgatfyqlhll
    ldkhageqlelidtvaervqtlggvavgdprhvaeittvprppdgveevpsmlsrlleah
    eliltechdaaartqeygddgtndllvsevlrtnelqawfvaehlvdtplvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cybB (B:)
    rtiqefgtvkqfpvaltmdtrlyscqrlnkvladtrilhdlykkyhwlmrgatfyqlhll
    ldkhageqlelidtvaervqtlggvavgdprhvaeittvprppdgveevpsmlsrlleah
    eliltechdaaartqeygddgtndllvsevlrtnelqawfvaehlvdtplvh
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.