PDB entry 4cxt

View 4cxt on RCSB PDB site
Description: BTB domain of KEAP1 in complex with CDDO
Class: signaling protein
Keywords: signaling protein, btb domain, keap1
Deposited on 2014-04-08, released 2014-06-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: 0.2122
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kelch-like ECH-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14145 (Start-136)
      • engineered mutation (128)
    Domains in SCOPe 2.07: d4cxta_
  • Heterogens: SXJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cxtA (A:)
    gshmgnrtfsytledhtkqafgimnelrlsqqlcdvtlqvkyqdapaaqfmahkvvlass
    spvfkamftnglreqgmevvsiegihpkvmerliefaytasismgekcvlhvmngavmyq
    idsvvracadflvqqld
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cxtA (A:)
    nrtfsytledhtkqafgimnelrlsqqlcdvtlqvkyqdapaaqfmahkvvlassspvfk
    amftnglreqgmevvsiegihpkvmerliefaytasismgekcvlhvmngavmyqidsvv
    racadflvqqld