PDB entry 4cxj

View 4cxj on RCSB PDB site
Description: BTB domain of KEAP1 C151W mutant
Class: transcription
Keywords: transcription
Deposited on 2014-04-07, released 2014-06-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2147
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kelch-like ECH-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14145
      • engineered mutation (107)
      • conflict (128)
    Domains in SCOPe 2.07: d4cxja_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cxjA (A:)
    gshmgnrtfsytledhtkqafgimnelrlsqqlcdvtlqvkyqdapaaqfmahkvvlass
    spvfkamftnglreqgmevvsiegihpkvmerliefaytasismgekwvlhvmngavmyq
    idsvvracadflvqqld
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cxjA (A:)
    nrtfsytledhtkqafgimnelrlsqqlcdvtlqvkyqdapaaqfmahkvvlassspvfk
    amftnglreqgmevvsiegihpkvmerliefaytasismgekwvlhvmngavmyqidsvv
    racadflvqql