PDB entry 4cvs

View 4cvs on RCSB PDB site
Description: Structure of Apobacterioferritin Y45F variant
Class: oxidoreductase
Keywords: oxidoreductase, ferritin, electron transfer
Deposited on 2014-03-29, released 2014-08-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-08-20, with a file datestamp of 2014-08-15.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: 0.204
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABD3 (1-End)
      • cloning artifact (0)
      • engineered mutation (45-46)
      • engineered mutation (112)
    Domains in SCOPe 2.04: d4cvsa_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cvsA (A:)
    amkgdtkvinylnkllgnelvainqyflharmfknwglkrlndvefresidemkhadryi
    erilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvrdyvsrdm
    mieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cvsA (A:)
    amkgdtkvinylnkllgnelvainqyflharmfknwglkrlndvefresidemkhadryi
    erilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvrdyvsrdm
    mieilrdeeghidwleteldliqkmglqnylqaqire