PDB entry 4cup

View 4cup on RCSB PDB site
Description: Crystal structure of human BAZ2B in complex with fragment-1 N09421
Class: transcription
Keywords: transcription
Deposited on 2014-03-21, released 2014-04-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain adjacent to zinc finger domain protein 2B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIF8 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d4cupa1, d4cupa2
  • Heterogens: ZYB, MOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cupA (A:)
    smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
    eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cupA (A:)
    smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
    eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfk