PDB entry 4cud

View 4cud on RCSB PDB site
Description: Human Notch1 EGF domains 11-13 mutant fucosylated at T466
Class: transcription
Keywords: transcription, metal-binding, transmembrane, developmental, protein, notch signaling pathway, differentiation, phosphorylation, egf-like domain, regulation, receptor, activator, ank repeat, signalling, glycoprotein, extracellular, egf, jagged, nucleus, membrane
Deposited on 2014-03-18, released 2014-05-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Neurogenic locus notch homolog protein 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P46531 (Start-117)
    • expression tag (118-124)
  Domains in SCOPe 2.08: d4cuda1, d4cuda2, d4cuda3, d4cuda4
• Heterogens: FUC, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4cudA (A:)
  saqdvdecslganpcehagkcintlgsfecqclqgytgprceidvnecvsnpcqndatcl
  dqigefqcicmpgyegvhcevntdecasspclhngrcldkinefqcecptgftghlcqvd
  lhhildaqkmvwnhr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4cudA (A:)
  dvdecslganpcehagkcintlgsfecqclqgytgprceidvnecvsnpcqndatcldqi
  gefqcicmpgyegvhcevntdecasspclhngrcldkinefqcecptgftghlcqvdlhh
  il