PDB entry 4ct5

View 4ct5 on RCSB PDB site
Description: ddx6
Class: hydrolase
Keywords: hydrolase
Deposited on 2014-03-12, released 2014-05-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.2329
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ddx6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ct5a1, d4ct5a2
  • Chain 'B':
    Compound: ddx6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ct5b1, d4ct5b2
  • Heterogens: ACT

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ct5A (A:)
    rsmgnefedyclkrellmgifemgwekpspiqeesipialsgrdilarakngtgksgayl
    ipllerldlkkdniqamvivptrelalqvsqiciqvskhmggakvmattggtnlrddimr
    lddtvhvviatpgrildlikkgvakvdhvqmivldeadkllsqdfvqimediiltlpknr
    qillysatfplsvqkfmnshlqkpyeinlmeeltlkgvtqyyayvterqkvhclntlfsr
    lqinqsiifcnssqrvellakkisqlgyscfyihakmrqehrnrvfhdfrnglcrnlvct
    dlftrgidiqavnvvinfdfpklaetylhrigrsgrfghlglainlityddrfnlksiee
    qlgteikpipsnidksly
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ct5A (A:)
    gnefedyclkrellmgifemgwekpspiqeesipialsgrdilarakngtgksgaylipl
    lerldlkkdniqamvivptrelalqvsqiciqvskhmggakvmattggtnlrddimrldd
    tvhvviatpgrildlikkgvakvdhvqmivldeadkllsqdfvqimediiltlpknrqil
    lysatfplsvqkfmnshlqkpyeinlmeeltlkgvtqyyayvterqkvhclntlfsrlqi
    nqsiifcnssqrvellakkisqlgyscfyihakmrqehrnrvfhdfrnglcrnlvctdlf
    trgidiqavnvvinfdfpklaetylhrigrsgrfghlglainlityddrfnlksieeqlg
    teikpipsnidksly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ct5B (B:)
    rsmgnefedyclkrellmgifemgwekpspiqeesipialsgrdilarakngtgksgayl
    ipllerldlkkdniqamvivptrelalqvsqiciqvskhmggakvmattggtnlrddimr
    lddtvhvviatpgrildlikkgvakvdhvqmivldeadkllsqdfvqimediiltlpknr
    qillysatfplsvqkfmnshlqkpyeinlmeeltlkgvtqyyayvterqkvhclntlfsr
    lqinqsiifcnssqrvellakkisqlgyscfyihakmrqehrnrvfhdfrnglcrnlvct
    dlftrgidiqavnvvinfdfpklaetylhrigrsgrfghlglainlityddrfnlksiee
    qlgteikpipsnidksly
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ct5B (B:)
    gnefedyclkrellmgifemgwekpspiqeesipialsgrdilarakngtgksgaylipl
    lerldlkkdniqamvivptrelalqvsqiciqvskhmggakvmattggtnlrddimrldd
    tvhvviatpgrildlikkgvakvdhvqmivldeadkllsqdfvqimediiltlpknrqil
    lysatfplsvqkfmnshlqkpyeinlmeeltlkgvtqyyayvterqkvhclntlfsrlqi
    nqsiifcnssqrvellakkisqlgyscfyihakmrqehrnrvfhdfrnglcrnlvctdlf
    trgidiqavnvvinfdfpklaetylhrigrsgrfghlglainlityddrfnlksieeqlg
    teikpipsnidksly