PDB entry 4csj

View 4csj on RCSB PDB site
Description: The discovery of potent selective glucocorticoid receptor modulators, suitable for inhalation
Class: signaling protein
Keywords: signaling protein, nuclear hormone receptor, ligand complex, peptide complex
Deposited on 2014-03-07, released 2014-05-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-05-21, with a file datestamp of 2014-05-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2193
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04150
      • engineered mutation (73)
      • engineered mutation (104)
      • engineered mutation (140)
    Domains in SCOPe 2.06: d4csja_
  • Chain 'B':
    Compound: nuclear receptor coactivator 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, NN7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4csjA (A:)
    gsiqqattgvsqetsenpgdktivpatlpqltptlvslleviepevlyagydssvpdstw
    rimttlnmlggrqmiaavkwakaipgfrnlhlddqmtllqyswmslmafalgwrsyrqss
    anllcfapdliineqrmtlpdmydqckhmlyvsselhrlqvsyeeylcmktllllssvpk
    dglksqelfdeirmtyikelgkaivkregnssqnwqrfyqltklldsmhevvenllnycf
    qtfldktmsiefpemlaeiitnqipkysngnikkllfhqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4csjA (A:)
    ptlvslleviepevlyagydssvpdstwrimttlnmlggrqmiaavkwakaipgfrnlhl
    ddqmtllqyswmslmafalgwrsyrqssanllcfapdliineqrmtlpdmydqckhmlyv
    sselhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelgkaivkregnss
    qnwqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipkysngni
    kkllfhq
    

  • Chain 'B':
    No sequence available.