PDB entry 4crw

View 4crw on RCSB PDB site
Description: Complex of human DDX6 (RECA-C) and CNOT1 (MIF4G)
Class: gene regulation
Keywords: gene regulation, ccr4-not, translational repression, mRNA decapping, dead-box protein, p54, rck, helicase, mRNA silencing, mRNA deadenylation, eif4a, translation, mirna, p-bodies
Deposited on 2014-03-01, released 2014-05-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.1636
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CCR4-NOT transcription complex subunit 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5YKK6 (6-230)
      • expression tag (5)
  • Chain 'B':
    Compound: probable ATP-dependent RNA helicase ddx6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4crwb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4crwB (B:)
gpqdpkgvtqyyayvterqkvhclntlfsrlqinqsiifcnssqrvellakkisqlgysc
fyihakmrqehrnrvfhdfrnglcrnlvctdlftrgidiqavnvvinfdfpklaetylhr
igrsgrfghlglainlityddrfnlksieeqlgteikpipsnidkslyvaeyhsepvede
kp

    Sequence, based on observed residues (ATOM records): (download) 
    >4crwB (B:)
kgvtqyyayvterqkvhclntlfsrlqinqsiifcnssqrvellakkisqlgyscfyiha
kmrqehrnrvfhdfrnglcrnlvctdlftrgidiqavnvvinfdfpklaetylhrigrsg
rfghlglainlityddrfnlksieeqlgteikpipsni