PDB entry 4crh

View 4crh on RCSB PDB site
Description: Crystal structure of the BTB-T1 domain of human SHKBP1
Class: protein-binding protein
Keywords: protein-binding protein
Deposited on 2014-02-26, released 2014-03-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.1651
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sh3kbp1-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TBC3 (23-125)
      • expression tag (22)
    Domains in SCOPe 2.06: d4crha1, d4crha2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4crhA (A:)
mhhhhhhssgvdlgtenlyfqsmgevihlnvggkrfstsrqtltwipdsffssllsgris
tlkdetgaifidrdptvfapilnflrtkeldprgvhgssllheaqfygltplvrrlqlre
eldrss

    Sequence, based on observed residues (ATOM records): (download) 
    >4crhA (A:)
mgevihlnvggkrfstsrqtltwipdsffssllstlkdetgaifidrdptvfapilnflr
tkeldssllheaqfygltplvrrlqlreeldrss