PDB entry 4cr0

View 4cr0 on RCSB PDB site
Description: Crystal Structure of H5 (VN1194) Asn186Lys/Gly143Arg Mutant Haemagglutinin
Class: viral protein
Keywords: viral protein, sialic acid, glycoprotein, virus receptor, avian flu, sialyllactosamine, 3sln, 3'sln, 6sln, 6'sln, lsta
Deposited on 2014-02-21, released 2014-05-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-11, with a file datestamp of 2014-06-06.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.22651
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: haemagglutinin ha1
    Species: INFLUENZA A VIRUS (A/VIETNAM/1194/2004(H5N1)) [TaxId:644788]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ34 (0-End)
      • engineered mutation (138)
      • engineered mutation (181)
    Domains in SCOPe 2.07: d4cr0a_
  • Chain 'B':
    Compound: haemagglutinin ha2
    Species: INFLUENZA A VIRUS (A/VIETNAM/1194/2004(H5N1)) [TaxId:644788]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ34 (0-End)
      • conflict (159)
    Domains in SCOPe 2.07: d4cr0b_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cr0A (A:)
    dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
    llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
    swssheaslgvssacpyqrkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
    pkdaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
    fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
    ecpkyvksnrlvlatglrnspqretr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cr0A (A:)
    dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
    llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
    swssheaslgvssacpyqrkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
    pkdaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
    fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
    ecpkyvksnrlvlatglrnsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cr0B (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydysqyseea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cr0B (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydys