PDB entry 4cq1

View 4cq1 on RCSB PDB site
Description: Crystal structure of the neuronal isoform of PTB
Class: translation
Keywords: translation, RNA binding protein, nptb, brptb
Deposited on 2014-02-10, released 2014-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polypyrimidine tract-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cq1a1, d4cq1a2
  • Chain 'B':
    Compound: polypyrimidine tract-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cq1b1, d4cq1b2
  • Chain 'C':
    Compound: polypyrimidine tract-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cq1c1, d4cq1c2
  • Chain 'D':
    Compound: polypyrimidine tract-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cq1d1, d4cq1d2
  • Chain 'E':
    Compound: polypyrimidine tract-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cq1e1, d4cq1e2
  • Chain 'F':
    Compound: polypyrimidine tract-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cq1f1, d4cq1f2
  • Chain 'G':
    Compound: polypyrimidine tract-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cq1g1, d4cq1g2
  • Chain 'H':
    Compound: polypyrimidine tract-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cq1h1, d4cq1h2
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cq1A (A:)
    gntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhl
    ngqkmygkiirvtlskhqtvqlpreglddqgltkdfgnsplhrfkkpgsknfqnifppsa
    tlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnyn
    lgenhhlrvsfsksti
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cq1A (A:)
    ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
    gqkmygkiirvtlskhqtvqlprdqgltkdfgnsplhrfkkpgsknfqnifppsatlhls
    nippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnynlgenh
    hlrvsfsksti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cq1B (B:)
    gntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhl
    ngqkmygkiirvtlskhqtvqlpreglddqgltkdfgnsplhrfkkpgsknfqnifppsa
    tlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnyn
    lgenhhlrvsfsksti
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cq1B (B:)
    gntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhl
    ngqkmygkiirvtlskhqtvqlprdqgltkdfgnsplhrfkkpgsknfqnifppsatlhl
    snippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnynlgen
    hhlrvsfsksti
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4cq1C (C:)
    gntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhl
    ngqkmygkiirvtlskhqtvqlpreglddqgltkdfgnsplhrfkkpgsknfqnifppsa
    tlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnyn
    lgenhhlrvsfsksti
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cq1C (C:)
    ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
    gqkmygkiirvtlskhqtvqlpgltkdfgnsplhrfkkpgsknfqnifppsatlhlsnip
    psvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnynlgenhhlr
    vsfsksti
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4cq1D (D:)
    gntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhl
    ngqkmygkiirvtlskhqtvqlpreglddqgltkdfgnsplhrfkkpgsknfqnifppsa
    tlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnyn
    lgenhhlrvsfsksti
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cq1D (D:)
    ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
    gqkmygkiirvtlskhqtvqlprgltkdfgnsplhrfkkpgsknfqnifppsatlhlsni
    ppsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnynlgenhhl
    rvsfsksti
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4cq1E (E:)
    gntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhl
    ngqkmygkiirvtlskhqtvqlpreglddqgltkdfgnsplhrfkkpgsknfqnifppsa
    tlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnyn
    lgenhhlrvsfsksti
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cq1E (E:)
    ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
    gqkmygkiirvtlskhqtvqlprgltkdfgnsplhrfkkpgsknfqnifppsatlhlsni
    ppsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnynlgenhhl
    rvsfsksti
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4cq1F (F:)
    gntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhl
    ngqkmygkiirvtlskhqtvqlpreglddqgltkdfgnsplhrfkkpgsknfqnifppsa
    tlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnyn
    lgenhhlrvsfsksti
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cq1F (F:)
    ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
    gqkmygkiirvtlskhqtvqlprdqgltkdfgnsplhrfkkpgsknfqnifppsatlhls
    nippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnynlgenh
    hlrvsfsksti
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4cq1G (G:)
    gntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhl
    ngqkmygkiirvtlskhqtvqlpreglddqgltkdfgnsplhrfkkpgsknfqnifppsa
    tlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnyn
    lgenhhlrvsfsksti
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cq1G (G:)
    ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
    gqkmygkiirvtlskhqtvqlprdqgltkdfgnsplhrfkkpgsknfqnifppsatlhls
    nippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnynlgenh
    hlrvsfsksti
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4cq1H (H:)
    gntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhl
    ngqkmygkiirvtlskhqtvqlpreglddqgltkdfgnsplhrfkkpgsknfqnifppsa
    tlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnyn
    lgenhhlrvsfsksti
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cq1H (H:)
    ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
    gqkmygkiirvtlskhqtvqlprdqgltkdfgnsplhrfkkpgsknfqnifppsatlhls
    nippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnynlgenh
    hlrvsfsksti