PDB entry 4cpz

View 4cpz on RCSB PDB site
Description: Structure of the Neuraminidase from the B-Lyon-CHU-15.216-2011 virus in complex with Zanamivir
Class: hydrolase
Keywords: hydrolase, neuraminidase inhibitor, relenza
Deposited on 2014-02-09, released 2014-05-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: INFLUENZA B VIRUS [TaxId:11520]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CPZ (Start-465)
    Domains in SCOPe 2.07: d4cpza_
  • Chain 'B':
    Compound: Neuraminidase
    Species: INFLUENZA B VIRUS [TaxId:11520]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CPZ (Start-465)
    Domains in SCOPe 2.07: d4cpzb_
  • Chain 'C':
    Compound: Neuraminidase
    Species: INFLUENZA B VIRUS [TaxId:11520]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CPZ (Start-465)
    Domains in SCOPe 2.07: d4cpzc_
  • Chain 'D':
    Compound: Neuraminidase
    Species: INFLUENZA B VIRUS [TaxId:11520]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CPZ (Start-465)
    Domains in SCOPe 2.07: d4cpzd_
  • Chain 'E':
    Compound: Neuraminidase
    Species: INFLUENZA B VIRUS [TaxId:11520]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CPZ (Start-465)
    Domains in SCOPe 2.07: d4cpze_
  • Chain 'F':
    Compound: Neuraminidase
    Species: INFLUENZA B VIRUS [TaxId:11520]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CPZ (Start-465)
    Domains in SCOPe 2.07: d4cpzf_
  • Chain 'G':
    Compound: Neuraminidase
    Species: INFLUENZA B VIRUS [TaxId:11520]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CPZ (Start-465)
    Domains in SCOPe 2.07: d4cpzg_
  • Chain 'H':
    Compound: Neuraminidase
    Species: INFLUENZA B VIRUS [TaxId:11520]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CPZ (Start-465)
    Domains in SCOPe 2.07: d4cpzh_
  • Heterogens: CA, NAG, ZMR, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cpzA (A:)
    mlpstiqtltlfltsggvllslyvsallsyllysdillkfspteitaptmsldcanasnv
    qavnrsatkgvtfllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfi
    acgpneckhfalthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgs
    achdgkewtyigvdgpdndallkvkygeaytdtyhsyankllrtqesacnciggncylmi
    tdgsasgvsecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakr
    pfvklnvetdtaeirlmctdtyldtprpddgsitgpcesngdkgsggikggfvhqrmesk
    igrwysrtmsktermgmglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkec
    dvpcigiemvhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cpzA (A:)
    epewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpneckhfalthya
    aqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgp
    dndallkvkygeaytdtyhsyankllrtqesacnciggncylmitdgsasgvsecrflki
    regriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
    mctdtyldtprpddgsitgpcesngdkgsggikggfvhqrmeskigrwysrtmsktermg
    mglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkecdvpcigiemvhdggke
    twhsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cpzB (B:)
    mlpstiqtltlfltsggvllslyvsallsyllysdillkfspteitaptmsldcanasnv
    qavnrsatkgvtfllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfi
    acgpneckhfalthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgs
    achdgkewtyigvdgpdndallkvkygeaytdtyhsyankllrtqesacnciggncylmi
    tdgsasgvsecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakr
    pfvklnvetdtaeirlmctdtyldtprpddgsitgpcesngdkgsggikggfvhqrmesk
    igrwysrtmsktermgmglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkec
    dvpcigiemvhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cpzB (B:)
    epewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpneckhfalthya
    aqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgp
    dndallkvkygeaytdtyhsyankllrtqesacnciggncylmitdgsasgvsecrflki
    regriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
    mctdtyldtprpddgsitgpcesngdkgsggikggfvhqrmeskigrwysrtmsktermg
    mglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkecdvpcigiemvhdggke
    twhsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4cpzC (C:)
    mlpstiqtltlfltsggvllslyvsallsyllysdillkfspteitaptmsldcanasnv
    qavnrsatkgvtfllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfi
    acgpneckhfalthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgs
    achdgkewtyigvdgpdndallkvkygeaytdtyhsyankllrtqesacnciggncylmi
    tdgsasgvsecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakr
    pfvklnvetdtaeirlmctdtyldtprpddgsitgpcesngdkgsggikggfvhqrmesk
    igrwysrtmsktermgmglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkec
    dvpcigiemvhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cpzC (C:)
    epewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpneckhfalthya
    aqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgp
    dndallkvkygeaytdtyhsyankllrtqesacnciggncylmitdgsasgvsecrflki
    regriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
    mctdtyldtprpddgsitgpcesngdkgsggikggfvhqrmeskigrwysrtmsktermg
    mglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkecdvpcigiemvhdggke
    twhsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4cpzD (D:)
    mlpstiqtltlfltsggvllslyvsallsyllysdillkfspteitaptmsldcanasnv
    qavnrsatkgvtfllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfi
    acgpneckhfalthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgs
    achdgkewtyigvdgpdndallkvkygeaytdtyhsyankllrtqesacnciggncylmi
    tdgsasgvsecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakr
    pfvklnvetdtaeirlmctdtyldtprpddgsitgpcesngdkgsggikggfvhqrmesk
    igrwysrtmsktermgmglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkec
    dvpcigiemvhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cpzD (D:)
    epewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpneckhfalthya
    aqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgp
    dndallkvkygeaytdtyhsyankllrtqesacnciggncylmitdgsasgvsecrflki
    regriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
    mctdtyldtprpddgsitgpcesngdkgsggikggfvhqrmeskigrwysrtmsktermg
    mglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkecdvpcigiemvhdggke
    twhsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4cpzE (E:)
    mlpstiqtltlfltsggvllslyvsallsyllysdillkfspteitaptmsldcanasnv
    qavnrsatkgvtfllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfi
    acgpneckhfalthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgs
    achdgkewtyigvdgpdndallkvkygeaytdtyhsyankllrtqesacnciggncylmi
    tdgsasgvsecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakr
    pfvklnvetdtaeirlmctdtyldtprpddgsitgpcesngdkgsggikggfvhqrmesk
    igrwysrtmsktermgmglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkec
    dvpcigiemvhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cpzE (E:)
    epewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpneckhfalthya
    aqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgp
    dndallkvkygeaytdtyhsyankllrtqesacnciggncylmitdgsasgvsecrflki
    regriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
    mctdtyldtprpddgsitgpcesngdkgsggikggfvhqrmeskigrwysrtmsktermg
    mglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkecdvpcigiemvhdggke
    twhsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4cpzF (F:)
    mlpstiqtltlfltsggvllslyvsallsyllysdillkfspteitaptmsldcanasnv
    qavnrsatkgvtfllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfi
    acgpneckhfalthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgs
    achdgkewtyigvdgpdndallkvkygeaytdtyhsyankllrtqesacnciggncylmi
    tdgsasgvsecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakr
    pfvklnvetdtaeirlmctdtyldtprpddgsitgpcesngdkgsggikggfvhqrmesk
    igrwysrtmsktermgmglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkec
    dvpcigiemvhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cpzF (F:)
    epewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpneckhfalthya
    aqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgp
    dndallkvkygeaytdtyhsyankllrtqesacnciggncylmitdgsasgvsecrflki
    regriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
    mctdtyldtprpddgsitgpcesngdkgsggikggfvhqrmeskigrwysrtmsktermg
    mglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkecdvpcigiemvhdggke
    twhsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4cpzG (G:)
    mlpstiqtltlfltsggvllslyvsallsyllysdillkfspteitaptmsldcanasnv
    qavnrsatkgvtfllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfi
    acgpneckhfalthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgs
    achdgkewtyigvdgpdndallkvkygeaytdtyhsyankllrtqesacnciggncylmi
    tdgsasgvsecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakr
    pfvklnvetdtaeirlmctdtyldtprpddgsitgpcesngdkgsggikggfvhqrmesk
    igrwysrtmsktermgmglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkec
    dvpcigiemvhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cpzG (G:)
    epewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpneckhfalthya
    aqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgp
    dndallkvkygeaytdtyhsyankllrtqesacnciggncylmitdgsasgvsecrflki
    regriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
    mctdtyldtprpddgsitgpcesngdkgsggikggfvhqrmeskigrwysrtmsktermg
    mglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkecdvpcigiemvhdggke
    twhsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4cpzH (H:)
    mlpstiqtltlfltsggvllslyvsallsyllysdillkfspteitaptmsldcanasnv
    qavnrsatkgvtfllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfi
    acgpneckhfalthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgs
    achdgkewtyigvdgpdndallkvkygeaytdtyhsyankllrtqesacnciggncylmi
    tdgsasgvsecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakr
    pfvklnvetdtaeirlmctdtyldtprpddgsitgpcesngdkgsggikggfvhqrmesk
    igrwysrtmsktermgmglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkec
    dvpcigiemvhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cpzH (H:)
    epewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpneckhfalthya
    aqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgp
    dndallkvkygeaytdtyhsyankllrtqesacnciggncylmitdgsasgvsecrflki
    regriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
    mctdtyldtprpddgsitgpcesngdkgsggikggfvhqrmeskigrwysrtmsktermg
    mglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkecdvpcigiemvhdggke
    twhsaataiyclmgsgqllwdtvtgvdmal