PDB entry 4cpo

View 4cpo on RCSB PDB site
Description: Structure of the Neuraminidase from the B/Lyon/CHU/15.216/2011 virus
Class: hydrolase
Keywords: hydrolase, influenza, neuraminidase
Deposited on 2014-02-08, released 2014-05-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.1546
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: INFLUENZA B VIRUS [TaxId:11520]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CPO (Start-465)
    Domains in SCOPe 2.07: d4cpoa_
  • Chain 'B':
    Compound: Neuraminidase
    Species: INFLUENZA B VIRUS [TaxId:11520]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CPO (Start-465)
    Domains in SCOPe 2.07: d4cpob_
  • Heterogens: NAG, CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cpoA (A:)
    mlpstiqtltlfltsggvllslyvsallsyllysdillkfspteitaptmsldcanasnv
    qavnrsatkgvtfllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfi
    acgpneckhfalthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgs
    achdgkewtyigvdgpdndallkvkygeaytdtyhsyankllrtqesacnciggncylmi
    tdgsasgvsecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakr
    pfvklnvetdtaeirlmctdtyldtprpddgsitgpcesngdkgsggikggfvhqrmesk
    igrwysrtmsktermgmglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkec
    dvpcigiemvhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cpoA (A:)
    epewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpneckhfalthya
    aqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgp
    dndallkvkygeaytdtyhsyankllrtqesacnciggncylmitdgsasgvsecrflki
    regriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
    mctdtyldtprpddgsitgpcesngdkgsggikggfvhqrmeskigrwysrtmsktermg
    mglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkecdvpcigiemvhdggke
    twhsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cpoB (B:)
    mlpstiqtltlfltsggvllslyvsallsyllysdillkfspteitaptmsldcanasnv
    qavnrsatkgvtfllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfi
    acgpneckhfalthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgs
    achdgkewtyigvdgpdndallkvkygeaytdtyhsyankllrtqesacnciggncylmi
    tdgsasgvsecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakr
    pfvklnvetdtaeirlmctdtyldtprpddgsitgpcesngdkgsggikggfvhqrmesk
    igrwysrtmsktermgmglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkec
    dvpcigiemvhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cpoB (B:)
    epewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpneckhfalthya
    aqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgp
    dndallkvkygeaytdtyhsyankllrtqesacnciggncylmitdgsasgvsecrflki
    regriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
    mctdtyldtprpddgsitgpcesngdkgsggikggfvhqrmeskigrwysrtmsktermg
    mglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkecdvpcigiemvhdggke
    twhsaataiyclmgsgqllwdtvtgvdmal