PDB entry 4cpm

View 4cpm on RCSB PDB site
Description: Structure of the Neuraminidase from the B/Brisbane/60/2008 virus in complex with Oseltamivir
Class: hydrolase
Keywords: hydrolase, viral protein, oseltamivir
Deposited on 2014-02-07, released 2014-05-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.1619
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: INFLUENZA B VIRUS (B/BRISBANE/60/2008) [TaxId:604436]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cpma_
  • Chain 'B':
    Compound: Neuraminidase
    Species: INFLUENZA B VIRUS (B/BRISBANE/60/2008) [TaxId:604436]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cpmb_
  • Heterogens: CA, NAG, G39, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cpmA (A:)
    mlpstiqtltlfltsggvllslyvsaslsyllysdillkfspteitaptmpldcanasnv
    qavnrsatkgvtlllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfi
    acgpneckhfalthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgs
    achdgkewtyigvdgpdnnallkvkygeaytdtyhsyankilrtqesacnciggncylmi
    tdgsasgvsecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakr
    pfvklnvetdtaeirlmctdtyldtprpndgsitgpcesngdkgsggikggfvhqrmesk
    igrwysrtmsktermgmglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkkc
    dvpcigiemvhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cpmA (A:)
    epewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpneckhfalthya
    aqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgp
    dnnallkvkygeaytdtyhsyankilrtqesacnciggncylmitdgsasgvsecrflki
    regriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
    mctdtyldtprpndgsitgpcesngdkgsggikggfvhqrmeskigrwysrtmsktermg
    mglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkkcdvpcigiemvhdggke
    twhsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cpmB (B:)
    mlpstiqtltlfltsggvllslyvsaslsyllysdillkfspteitaptmpldcanasnv
    qavnrsatkgvtlllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfi
    acgpneckhfalthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgs
    achdgkewtyigvdgpdnnallkvkygeaytdtyhsyankilrtqesacnciggncylmi
    tdgsasgvsecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakr
    pfvklnvetdtaeirlmctdtyldtprpndgsitgpcesngdkgsggikggfvhqrmesk
    igrwysrtmsktermgmglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkkc
    dvpcigiemvhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cpmB (B:)
    epewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpneckhfalthya
    aqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgp
    dnnallkvkygeaytdtyhsyankilrtqesacnciggncylmitdgsasgvsecrflki
    regriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
    mctdtyldtprpndgsitgpcesngdkgsggikggfvhqrmeskigrwysrtmsktermg
    mglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkkcdvpcigiemvhdggke
    twhsaataiyclmgsgqllwdtvtgvdmal