PDB entry 4cpk

View 4cpk on RCSB PDB site
Description: Crystal structure of PBP2a double clinical mutant N146K-E150K from MRSA
Class: hydrolase
Keywords: hydrolase, penicillin-binding protein, mrsa, allosteric site
Deposited on 2014-02-07, released 2014-09-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-09-10, with a file datestamp of 2014-09-05.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.1841
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penicillin binding protein 2 prime
    Species: Staphylococcus aureus subsp. aureus Mu50 [TaxId:158878]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54113 (Start-642)
      • engineered mutation (120)
      • engineered mutation (124)
  • Chain 'B':
    Compound: penicillin binding protein 2 prime
    Species: Staphylococcus aureus subsp. aureus Mu50 [TaxId:158878]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54113 (Start-642)
      • engineered mutation (120)
      • engineered mutation (124)
    Domains in SCOPe 2.04: d4cpkb1, d4cpkb2, d4cpkb3
  • Heterogens: CD, CL, MUR, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cpkB (B:)
    kdkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrki
    kkvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsihie
    klkskrgkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmdqnw
    vqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgpinseelk
    qkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgkdiq
    ltidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynklte
    dkkepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtr
    yevvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisn
    knldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisk
    eninlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydkdnp
    nmmmainvkdvqdkgmasynakisgkvydelyengnkkydide
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cpkB (B:)
    dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
    kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsihiek
    lkskrgkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmdqnwv
    qddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgpinseelkq
    keykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgkdiql
    tidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynklted
    kkepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtry
    evvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnk
    nldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniiske
    ninlltdgmqqvvnkthkediyrsyanligksgtaeltgrqigwfisydkdnpnmmmain
    vkdvqdkgmasynakisgkvydelyengnkkydide