PDB entry 4cp3

View 4cp3 on RCSB PDB site
Description: The structure of BCL6 BTB (POZ) domain in complex with the ansamycin antibiotic rifabutin.
Class: immune system
Keywords: immune system, btb/poz, transcriptional repressor, rifamycin, antibiotic, smrt, inhibitor
Deposited on 2014-01-31, released 2014-03-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.20193
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-cell lymphoma 6 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41182 (4-End)
      • expression tag (1-3)
      • engineered mutation (62)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d4cp3a1, d4cp3a2
  • Chain 'B':
    Compound: B-cell lymphoma 6 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41182 (4-123)
      • expression tag (2-3)
      • engineered mutation (62)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d4cp3b1, d4cp3b2
  • Heterogens: RBT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cp3A (A:)
    gasqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdq
    lkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkf
    ikas
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cp3A (A:)
    asqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdql
    krnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfi
    ka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cp3B (B:)
    gasqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdq
    lkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkf
    ikas
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cp3B (B:)
    sqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlk
    rnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfik
    as