PDB entry 4co8

View 4co8 on RCSB PDB site
Description: Structure of the DNA binding ETS domain of human ETV4
Class: transcription
Keywords: transcription
Deposited on 2014-01-27, released 2014-02-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.11727
AEROSPACI score: 0.91 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ets translocation variant 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43268 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.04: d4co8a_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4co8A (A:)
    smrgalqlwqflvallddptnahfiawtgrgmefkliepeevarlwgiqknrpamnydkl
    srslryyyekgimqkvageryvykfvcepealfslafpdnqrpalkaefdrpvseedtvp
    lshldespaylpela
    

    Sequence, based on observed residues (ATOM records): (download)
    >4co8A (A:)
    mrgalqlwqflvallddptnahfiawtgrgmefkliepeevarlwgiqknrpamnydkls
    rslryyyekgimqkvageryvykfvcepealfslafpd