PDB entry 4cnw

View 4cnw on RCSB PDB site
Description: Surface residue engineering of bovine carbonic anhydrase to an extreme halophilic enzyme for potential application in postcombustion CO2 capture
Class: lyase
Keywords: lyase, protein engineering, co2 capture
Deposited on 2014-01-25, released 2015-02-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00921 (Start-261)
      • engineered mutation (9)
      • engineered mutation (25)
      • engineered mutation (37)
      • engineered mutation (40)
      • engineered mutation (51)
      • engineered mutation (58)
      • engineered mutation (63)
      • engineered mutation (75)
      • engineered mutation (137)
      • engineered mutation (170)
      • engineered mutation (239)
      • engineered mutation (253)
    Domains in SCOPe 2.06: d4cnwa_
  • Chain 'B':
    Compound: Carbonic anhydrase 2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00921 (Start-261)
      • engineered mutation (9)
      • engineered mutation (25)
      • engineered mutation (37)
      • engineered mutation (40)
      • engineered mutation (51)
      • engineered mutation (58)
      • engineered mutation (63)
      • engineered mutation (75)
      • engineered mutation (137)
      • engineered mutation (170)
      • engineered mutation (239)
      • engineered mutation (253)
    Domains in SCOPe 2.06: d4cnwb_
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cnwA (A:)
    mgmshhwgydkhngpehwhkdfpiadgerqspvdidtdavdqdpalkplaldygeatsdr
    mvndghsfnveyddsedkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaael
    hlvhwntkygdfgtaaqepdglavvgvflkvgdanpalqkvldaldsiktegkstdfpnf
    dpgsllpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepee
    lmlanwrpaqplkdrqvrgfpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cnwA (A:)
    hwgydkhngpehwhkdfpiadgerqspvdidtdavdqdpalkplaldygeatsdrmvndg
    hsfnveyddsedkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelhlvhw
    ntkygdfgtaaqepdglavvgvflkvgdanpalqkvldaldsiktegkstdfpnfdpgsl
    lpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepeelmlan
    wrpaqplkdrqvrgfpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cnwB (B:)
    mgmshhwgydkhngpehwhkdfpiadgerqspvdidtdavdqdpalkplaldygeatsdr
    mvndghsfnveyddsedkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaael
    hlvhwntkygdfgtaaqepdglavvgvflkvgdanpalqkvldaldsiktegkstdfpnf
    dpgsllpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepee
    lmlanwrpaqplkdrqvrgfpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cnwB (B:)
    hhwgydkhngpehwhkdfpiadgerqspvdidtdavdqdpalkplaldygeatsdrmvnd
    ghsfnveyddsedkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelhlvh
    wntkygdfgtaaqepdglavvgvflkvgdanpalqkvldaldsiktegkstdfpnfdpgs
    llpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepeelmla
    nwrpaqplkdrqvrgfpk