PDB entry 4cnr

View 4cnr on RCSB PDB site
Description: Surface residue engineering of bovine carbonic anhydrase to an extreme halophilic enzyme for potential application in postcombustion CO2 capture
Class: lyase
Keywords: lyase, protein engineering, co2 capture
Deposited on 2014-01-24, released 2015-02-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00921 (Start-261)
      • engineered mutation (9)
      • engineered mutation (37)
      • engineered mutation (51)
      • engineered mutation (63)
      • engineered mutation (137)
      • engineered mutation (239)
    Domains in SCOPe 2.06: d4cnra_
  • Chain 'B':
    Compound: Carbonic anhydrase 2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00921 (Start-261)
      • engineered mutation (9)
      • engineered mutation (37)
      • engineered mutation (51)
      • engineered mutation (63)
      • engineered mutation (137)
      • engineered mutation (239)
    Domains in SCOPe 2.06: d4cnrb_
  • Chain 'C':
    Compound: Carbonic anhydrase 2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00921 (Start-261)
      • engineered mutation (9)
      • engineered mutation (37)
      • engineered mutation (51)
      • engineered mutation (63)
      • engineered mutation (137)
      • engineered mutation (239)
    Domains in SCOPe 2.06: d4cnrc_
  • Chain 'D':
    Compound: Carbonic anhydrase 2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00921 (Start-261)
      • engineered mutation (9)
      • engineered mutation (37)
      • engineered mutation (51)
      • engineered mutation (63)
      • engineered mutation (137)
      • engineered mutation (239)
    Domains in SCOPe 2.06: d4cnrd_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cnrA (A:)
    mgmshhwgydkhngpehwhkdfpiangerqspvdidtdavvqdpalkplaldygeatsrr
    mvndghsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaael
    hlvhwntkygdfgtaaqepdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnf
    dpgsllpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepee
    lmlanwrpaqplknrqvrgfpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cnrA (A:)
    hwgydkhngpehwhkdfpiangerqspvdidtdavvqdpalkplaldygeatsrrmvndg
    hsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelhlvhw
    ntkygdfgtaaqepdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnfdpgsl
    lpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepeelmlan
    wrpaqplknrqvrgfpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cnrB (B:)
    mgmshhwgydkhngpehwhkdfpiangerqspvdidtdavvqdpalkplaldygeatsrr
    mvndghsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaael
    hlvhwntkygdfgtaaqepdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnf
    dpgsllpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepee
    lmlanwrpaqplknrqvrgfpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cnrB (B:)
    hhwgydkhngpehwhkdfpiangerqspvdidtdavvqdpalkplaldygeatsrrmvnd
    ghsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelhlvh
    wntkygdfgtaaqepdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnfdpgs
    llpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepeelmla
    nwrpaqplknrqvrgfpk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4cnrC (C:)
    mgmshhwgydkhngpehwhkdfpiangerqspvdidtdavvqdpalkplaldygeatsrr
    mvndghsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaael
    hlvhwntkygdfgtaaqepdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnf
    dpgsllpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepee
    lmlanwrpaqplknrqvrgfpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cnrC (C:)
    hwgydkhngpehwhkdfpiangerqspvdidtdavvqdpalkplaldygeatsrrmvndg
    hsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelhlvhw
    ntkygdfgtaaqepdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnfdpgsl
    lpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepeelmlan
    wrpaqplknrqvrgfpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4cnrD (D:)
    mgmshhwgydkhngpehwhkdfpiangerqspvdidtdavvqdpalkplaldygeatsrr
    mvndghsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaael
    hlvhwntkygdfgtaaqepdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnf
    dpgsllpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepee
    lmlanwrpaqplknrqvrgfpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cnrD (D:)
    hhwgydkhngpehwhkdfpiangerqspvdidtdavvqdpalkplaldygeatsrrmvnd
    ghsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelhlvh
    wntkygdfgtaaqepdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnfdpgs
    llpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepeelmla
    nwrpaqplknrqvrgfpk