PDB entry 4cni

View 4cni on RCSB PDB site
Description: Crystal structure of the Fab portion of Olokizumab in complex with IL- 6
Class: immune system
Keywords: immune system, cdp6038, interleukin 6
Deposited on 2014-01-22, released 2014-04-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-04-30, with a file datestamp of 2014-04-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.17807
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: olokizumab heavy chain, fab portion
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CNI (0-219)
  • Chain 'B':
    Compound: olokizumab light chain, fab portion
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CNI (0-213)
    Domains in SCOPe 2.04: d4cnib1, d4cnib2
  • Chain 'C':
    Compound: interleukin-6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4cnic_
  • Chain 'D':
    Compound: interleukin-6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4cnid_
  • Chain 'H':
    Compound: olokizumab heavy chain, fab portion
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CNI (0-End)
  • Chain 'L':
    Compound: olokizumab light chain, fab portion
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CNI (0-213)
  • Heterogens: TAM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cniB (B:)
    diqmtqspsslsasvgdrvtitcqasqdigislswyqqkpgkapklliynannladgvps
    rfsgsgsgtdftltisslqpedfatyyclqhnsapytfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cniC (C:)
    phrqpltsseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgc
    fqsgfneetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknl
    daittpdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cniD (D:)
    phrqpltsseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgc
    fqsgfneetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknl
    daittpdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    No sequence available.