PDB entry 4cmy

View 4cmy on RCSB PDB site
Description: Chlorobium tepidum Ferritin
Class: metal transport
Keywords: metal transport, iron-storage protein, iron metabolism
Deposited on 2014-01-18, released 2014-11-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.19421
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4cmyd_
  • Chain 'E':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4cmyf_
  • Chain 'G':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4cmyg_
  • Chain 'H':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KBP5 (0-End)
      • conflict (144)
    Domains in SCOPe 2.04: d4cmyv_
  • Chain 'W':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4cmyD (D:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyD (D:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksv
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4cmyF (F:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyF (F:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4cmyG (G:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyG (G:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksv
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >4cmyV (V:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariidtmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyV (V:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariidtmdgralfrfdeevrksv
    

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.