PDB entry 4cmm
View 4cmm on RCSB PDB site
Description: Structure of human CD47 in complex with human Signal Regulatory Protein (SIRP) alpha v1
Class: signaling protein
Keywords: signaling protein, paired receptor, immunological, inhibitory
Deposited on
2014-01-16, released
2014-02-26
The last revision prior to the SCOPe 2.05 freeze date was dated
2014-04-16, with a file datestamp of
2014-04-11.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.1945
AEROSPACI score: 0.39
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: tyrosine-protein phosphatase non-receptor type substrate 1
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d4cmma_ - Chain 'B':
Compound: leukocyte surface antigen cd47
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q08722 (0-117)
- expression tag (118-119)
- engineered mutation (14)
- Heterogens: NAG, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>4cmmA (A:)
eeelqviqpdksvlvaagetatlrctatslipvgpiqwfrgagpgreliynqkeghfprv
ttvsdltkrnnmdfsirignitpadagtyycvkfrkgspddvefksgagtelsvrakpst
rhhhhhh
Sequence, based on observed residues (ATOM records): (download)
>4cmmA (A:)
elqviqpdksvlvaagetatlrctatslipvgpiqwfrgagpgreliynqkeghfprvtt
vsdltkrnnmdfsirignitpadagtyycvkfrkgspddvefksgagtelsvrakps
- Chain 'B':
No sequence available.