PDB entry 4cmm

View 4cmm on RCSB PDB site
Description: Structure of human CD47 in complex with human Signal Regulatory Protein (SIRP) alpha v1
Class: signaling protein
Keywords: signaling protein, paired receptor, immunological, inhibitory
Deposited on 2014-01-16, released 2014-02-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.1945
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein phosphatase non-receptor type substrate 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4cmma_
  • Chain 'B':
    Compound: leukocyte surface antigen cd47
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08722 (0-117)
      • expression tag (118-119)
      • engineered mutation (14)
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cmmA (A:)
    eeelqviqpdksvlvaagetatlrctatslipvgpiqwfrgagpgreliynqkeghfprv
    ttvsdltkrnnmdfsirignitpadagtyycvkfrkgspddvefksgagtelsvrakpst
    rhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmmA (A:)
    elqviqpdksvlvaagetatlrctatslipvgpiqwfrgagpgreliynqkeghfprvtt
    vsdltkrnnmdfsirignitpadagtyycvkfrkgspddvefksgagtelsvrakps
    

  • Chain 'B':
    No sequence available.