PDB entry 4cmh

View 4cmh on RCSB PDB site
Description: Crystal structure of CD38 with a novel CD38-targeting antibody SAR650984
Class: hydrolase/immune system
Keywords: hydrolase-immune system complex, multiple myeloma
Deposited on 2014-01-15, released 2014-07-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-10, with a file datestamp of 2014-09-05.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.1889
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosyl cyclase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28907
      • engineered mutation (55)
      • engineered mutation (119)
      • engineered mutation (164)
      • engineered mutation (174)
    Domains in SCOPe 2.06: d4cmha_
  • Chain 'B':
    Compound: heavy chain of sar650984-fab fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CMH (0-End)
  • Chain 'C':
    Compound: light chain of sar650984-fab fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CMH (0-End)
    Domains in SCOPe 2.06: d4cmhc1, d4cmhc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cmhA (A:)
    rwrqqwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditee
    dyqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefa
    tskinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgs
    vevhnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdkf
    lqcvknpedssctsei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmhA (A:)
    qqwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditeedyq
    plmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefatsk
    inyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgsvev
    hnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdkflqc
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4cmhC (C:)
    divmtqshlsmstslgdpvsitckasqdvstvvawyqqkpgqsprrliysasyryigvpd
    rftgsgagtdftftissvqaedlavyycqqhysppytfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmhC (C:)
    divmtqshlsmstslgdpvsitckasqdvstvvawyqqkpgqsprrliysasyryigvpd
    rftgsgagtdftftissvqaedlavyycqqhysppytfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge