PDB entry 4cl2

View 4cl2 on RCSB PDB site
Description: structure of periplasmic metal binding protein from candidatus liberibacter asiaticus
Class: transport protein
Keywords: transport protein
Deposited on 2014-01-11, released 2015-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-18, with a file datestamp of 2015-03-13.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Periplasmic solute binding protein
    Species: CANDIDATUS LIBERIBACTER ASIATICUS [TaxId:537021]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cl2a_
  • Heterogens: SO4, ACT, GOL, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cl2A (A:)
    ttqkkvvlssfsiigditqniakdlvtvttlveagndshsyqvtsadaikiqnadlilcn
    glhleetymkyftnlkkgtkiitvtdginpigvsedtsvdsepnphawmsltnamiyien
    irkaltaldpsnakkyelnareysekirnsilplktriekvdpekrwfvtsegclvylae
    dfgfkslylwpinsdserspsmmrhainqmrshkikfifsestnsdqpakqvayetnasy
    ggvlyvdslskpdgpaptyldllrfsltkivdtlf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cl2A (A:)
    kkvvlssfsiigditqniakdlvtvttlveagndshsyqvtsadaikiqnadlilcnglh
    leetymkyftnlkkgtkiitvtdginpigvsesepnphawmsltnamiyienirkaltal
    dpsnakkyelnareysekirnsilplktriekvdpekrwfvtsegclvylaedfgfksly
    lwpinsrspsmmrhainqmrshkikfifsestnsdqpakqvayetnasyggvlyvdslsk
    pdgpaptyldllrfsltkivdtlf