PDB entry 4cko

View 4cko on RCSB PDB site
Description: Crystal structure of the neuronal isoform of PTB
Class: translation
Keywords: translation, RNA binding protein, brptb
Deposited on 2014-01-07, released 2014-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.2306
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polypyrimidine tract-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ckoa2, d4ckoa3
  • Chain 'B':
    Compound: polypyrimidine tract-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ckob3, d4ckob4
  • Chain 'C':
    Compound: polypyrimidine tract-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ckoc3, d4ckoc4
  • Chain 'D':
    Compound: polypyrimidine tract-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ckod3, d4ckod4
  • Chain 'E':
    Compound: polypyrimidine tract-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ckoe3, d4ckoe4
  • Chain 'F':
    Compound: polypyrimidine tract-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ckof3, d4ckof4
  • Chain 'G':
    Compound: polypyrimidine tract-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ckog3, d4ckog4
  • Chain 'H':
    Compound: polypyrimidine tract-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ckoh3, d4ckoh4
  • Heterogens: CL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ckoA (A:)
    gntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhl
    ngqkmygkiirvtlskhqtvqlpreglddqgltkdfgnsplhrfkkpgsknfqnifppsa
    tlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnyn
    lgenhhlrvsfsksti
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ckoA (A:)
    ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
    gqkmygkiirvtlskhqtvqlprdqgltkdfgnsplhrfkkpgsknfqnifppsatlhls
    nippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnynlgenh
    hlrvsfsksti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ckoB (B:)
    gntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhl
    ngqkmygkiirvtlskhqtvqlpreglddqgltkdfgnsplhrfkkpgsknfqnifppsa
    tlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnyn
    lgenhhlrvsfsksti
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ckoB (B:)
    ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
    gqkmygkiirvtlskhqtvqlprdqgltkdfgnsplhrfkkpgsknfqnifppsatlhls
    nippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnynlgenh
    hlrvsfsksti
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ckoC (C:)
    gntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhl
    ngqkmygkiirvtlskhqtvqlpreglddqgltkdfgnsplhrfkkpgsknfqnifppsa
    tlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnyn
    lgenhhlrvsfsksti
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ckoC (C:)
    ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
    gqkmygkiirvtlskhqtvqlpgltkdfgnsplhrfkkpgsknfqnifppsatlhlsnip
    psvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnynlgenhhlr
    vsfsksti
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ckoD (D:)
    gntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhl
    ngqkmygkiirvtlskhqtvqlpreglddqgltkdfgnsplhrfkkpgsknfqnifppsa
    tlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnyn
    lgenhhlrvsfsksti
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ckoD (D:)
    ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
    gqkmygkiirvtlskhqtvqlprgltkdfgnsplhrfkkpgsknfqnifppsatlhlsni
    ppsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnynlgenhhl
    rvsfsksti
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4ckoE (E:)
    gntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhl
    ngqkmygkiirvtlskhqtvqlpreglddqgltkdfgnsplhrfkkpgsknfqnifppsa
    tlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnyn
    lgenhhlrvsfsksti
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ckoE (E:)
    ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
    gqkmygkiirvtlskhqtvqlprgltkdfgnsplhrfkkpgsknfqnifppsatlhlsni
    ppsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnynlgenhhl
    rvsfsksti
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4ckoF (F:)
    gntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhl
    ngqkmygkiirvtlskhqtvqlpreglddqgltkdfgnsplhrfkkpgsknfqnifppsa
    tlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnyn
    lgenhhlrvsfsksti
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ckoF (F:)
    ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
    gqkmygkiirvtlskhqtvqlprdqgltkdfgnsplhrfkkpgsknfqnifppsatlhls
    nippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnynlgenh
    hlrvsfsksti
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4ckoG (G:)
    gntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhl
    ngqkmygkiirvtlskhqtvqlpreglddqgltkdfgnsplhrfkkpgsknfqnifppsa
    tlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnyn
    lgenhhlrvsfsksti
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ckoG (G:)
    ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
    gqkmygkiirvtlskhqtvqlprdqgltkdfgnsplhrfkkpgsknfqnifppsatlhls
    nippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnynlgenh
    hlrvsfsksti
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4ckoH (H:)
    gntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhl
    ngqkmygkiirvtlskhqtvqlpreglddqgltkdfgnsplhrfkkpgsknfqnifppsa
    tlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnyn
    lgenhhlrvsfsksti
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ckoH (H:)
    ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
    gqkmygkiirvtlskhqtvqlprdqgltkdfgnsplhrfkkpgsknfqnifppsatlhls
    nippsvaeedlrtlfantggtvkafkffqdhkmallqmatveeaiqalidlhnynlgenh
    hlrvsfsksti