PDB entry 4ch0

View 4ch0 on RCSB PDB site
Description: RRM domain from C. elegans SUP-12
Class: transcription
Keywords: transcription, development
Deposited on 2013-11-27, released 2014-09-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'S':
    Compound: protein sup-12, isoform b
    Species: Caenorhabditis elegans [TaxId:6239]
    Database cross-references and differences (RAF-indexed):
    • Uniprot H2L051 (3-96)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4ch0s1, d4ch0s2

PDB Chain Sequences:

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ch0S (S:)
    gamgsrdtmftkifvgglpyhtsdktlheyfeqfgdieeavvitdrntqksrgygfvtmk
    drasaerackdpnpiidgrkanvnlaylgakprtnvq