PDB entry 4ch0

View 4ch0 on RCSB PDB site
Description: RRM domain from C. elegans SUP-12
Class: transcription
Keywords: transcription, development
Deposited on 2013-11-27, released 2014-09-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'S':
  Compound: protein sup-12, isoform b
  Species: Caenorhabditis elegans [TaxId:6239]
  Database cross-references and differences (RAF-indexed):
  • Uniprot H2L051 (3-96)
    • expression tag (0-2)
  Domains in SCOPe 2.08: d4ch0s1, d4ch0s2

PDB Chain Sequences:

• Chain 'S':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4ch0S (S:)
  gamgsrdtmftkifvgglpyhtsdktlheyfeqfgdieeavvitdrntqksrgygfvtmk
  drasaerackdpnpiidgrkanvnlaylgakprtnvq