PDB entry 4cey

View 4cey on RCSB PDB site
Description: Crystal structure of human Enterovirus 71 in complex with the uncoating inhibitor NLD
Class: virus
Keywords: virus, hand-foot-and-mouth disease, enterovirus uncoating, inhibitor
Deposited on 2013-11-12, released 2014-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.291
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp1
    Species: ENTEROVIRUS A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2ZUN0 (0-296)
      • conflict (97)
    Domains in SCOPe 2.07: d4ceya_
  • Chain 'B':
    Compound: vp2
    Species: ENTEROVIRUS A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ceyb_
  • Chain 'C':
    Compound: vp3
    Species: ENTEROVIRUS A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ceyc_
  • Chain 'D':
    Compound: vp4
    Species: ENTEROVIRUS A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 906, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ceyA (A:)
    gdrvadviessigdsvsralthalpaptgqntqvsshrldtgkvpalqaaeigassnasd
    esmietrcvlnshstaettldsffsraglvgeidlplegttnpngyanwdiditgyaqmr
    rkvelftymrfdaeftfvactptgevvpqllqymfvppgapkpdsreslawqtatnpsvf
    vklsdppaqvsvpfmspasayqwfydgyptfgehkqekdleygacpnnmmgtfsvrtvgt
    skskyplvvriymrmkhvrawiprpmrnqnylfkanpnyagnsikptgasrtaittl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ceyB (B:)
    spsaeacgysdrvaqltignstittqeaaniivgygewpsycsdsdatavdkptrpdvsv
    nrfytldtklweksskgwywkfpdvltetgvfgqnaqfhylyrsgfcihvqcnaskfhqg
    allvavlpeyvigtvaggtgtedthppykqtqpgadgfelqhpyvldagipisqltvcph
    qwinlrtnncatiivpyinalpfdsalnhcnfgllvvpispldydqgatpvipititlap
    mcsefaglrqavtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ceyB (B:)
    sdrvaqltignstittqeaaniivgygewpsycsdsdatavdkptrpdvsvnrfytldtk
    lweksskgwywkfpdvltetgvfgqnaqfhylyrsgfcihvqcnaskfhqgallvavlpe
    yvigtvaggtgtedthppykqtqpgadgfelqhpyvldagipisqltvcphqwinlrtnn
    catiivpyinalpfdsalnhcnfgllvvpispldydqgatpvipititlapmcsefaglr
    qavtq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ceyC (C:)
    gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt
    natslmerlrfpvsaqagkgelcavfradpgrngpwqstllgqlcgyytqwsgslevtfm
    ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisnthyrah
    ardgvfdyyttglvsiwyqtnyvvpigapntayiialaaaqknftmklckdasdilqtgt
    iq
    

  • Chain 'D':
    No sequence available.