PDB entry 4cdq

View 4cdq on RCSB PDB site
Description: Crystal structure of human Enterovirus 71 in complex with GPP2
Class: virus
Keywords: virus
Deposited on 2013-11-05, released 2014-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-19, with a file datestamp of 2015-08-14.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp1
    Species: ENTEROVIRUS A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cdqa_
  • Chain 'B':
    Compound: vp2
    Species: ENTEROVIRUS A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cdqb_
  • Chain 'C':
    Compound: vp3
    Species: ENTEROVIRUS A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cdqc_
  • Chain 'D':
    Compound: vp4
    Species: ENTEROVIRUS A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 7VR, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cdqA (A:)
    gdrvadviessigdsvsralthalpaptgqntqvsshrldtgkvpalqaaeigassnasd
    esmietrcvlnshstaettldsffsraglvgeidlplkgttnpngyanwdiditgyaqmr
    rkvelftymrfdaeftfvactptgevvpqllqymfvppgapkpdsreslawqtatnpsvf
    vklsdppaqvsvpfmspasayqwfydgyptfgehkqekdleygacpnnmmgtfsvrtvgt
    skskyplvvriymrmkhvrawiprpmrnqnylfkanpnyagnsikptgasrtaittl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cdqB (B:)
    spsaeacgysdrvaqltignstittqeaaniivgygewpsycsdsdatavdkptrpdvsv
    nrfytldtklweksskgwywkfpdvltetgvfgqnaqfhylyrsgfcihvqcnaskfhqg
    allvavlpeyvigtvaggtgtedthppykqtqpgadgfelqhpyvldagipisqltvcph
    qwinlrtnncatiivpyinalpfdsalnhcnfgllvvpispldydqgatpvipititlap
    mcsefaglrqavtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cdqB (B:)
    sdrvaqltignstittqeaaniivgygewpsycsdsdatavdkptrpdvsvnrfytldtk
    lweksskgwywkfpdvltetgvfgqnaqfhylyrsgfcihvqcnaskfhqgallvavlpe
    yvigtvaggtgtedthppykqtqpgadgfelqhpyvldagipisqltvcphqwinlrtnn
    catiivpyinalpfdsalnhcnfgllvvpispldydqgatpvipititlapmcsefaglr
    qavtq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cdqC (C:)
    gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt
    natslmerlrfpvsaqagkgelcavfradpgrngpwqstllgqlcgyytqwsgslevtfm
    ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisnthyrah
    ardgvfdyyttglvsiwyqtnyvvpigapntayiialaaaqknftmklckdasdilqtgt
    iq
    

  • Chain 'D':
    No sequence available.