PDB entry 4cdh

View 4cdh on RCSB PDB site
Description: Crystallographic structure of the Human Igg1 alpha 2-6 sialilated Fc-Fragment
Class: immune system
Keywords: immune system, c-lectin crd, sign-r1, inmune system, capsular polysaccharide
Deposited on 2013-10-31, released 2014-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-25, with a file datestamp of 2015-02-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.23647
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cdha1, d4cdha2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cdhb1, d4cdhb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cdhA (A:)
    mkktaiaiavalagfatvaqadveskscdkthtcppcpapellggpsvflfppkpkdtlm
    isrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynstyrvvsvltvlhqd
    wlngkeykckvsnkalpapiektiskakgqprepqvytlppsrdeltknqvsltclvkgf
    ypsdiavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvfscsvmheal
    hnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cdhA (A:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn
    styrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrde
    ltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cdhB (B:)
    mkktaiaiavalagfatvaqadveskscdkthtcppcpapellggpsvflfppkpkdtlm
    isrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynstyrvvsvltvlhqd
    wlngkeykckvsnkalpapiektiskakgqprepqvytlppsrdeltknqvsltclvkgf
    ypsdiavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvfscsvmheal
    hnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cdhB (B:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    deltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslsl