PDB entry 4cdg

View 4cdg on RCSB PDB site
Description: Crystal structure of the Bloom's syndrome helicase BLM in complex with Nanobody
Class: hydrolase
Keywords: hydrolase
Deposited on 2013-10-31, released 2013-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-10, with a file datestamp of 2015-06-05.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bloom syndrome protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Bloom syndrome protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4CDG
    Domains in SCOPe 2.07: d4cdgc1, d4cdgc2
  • Chain 'D':
    Compound: Nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4CDG
    Domains in SCOPe 2.07: d4cdgd1, d4cdgd2
  • Heterogens: ADP, ZN

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4cdgC (C:)
    mkyllptaaagllllaaqpamaqvqlqesggglvqaggslrlscaasgiwfsinnmawyr
    qtpgkqreriaiitsagttnyvdsvkgrftisrddakntmylqmnslipedtavyycnlv
    adydmgfqsfwgrgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cdgC (C:)
    qvqlqesggglvqaggslrlscaasgiwfsinnmawyrqtpgkqreriaiitsagttnyv
    dsvkgrftisrddakntmylqmnslipedtavyycnlvadydmgfqsfwgrgtqvtvssh
    hh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4cdgD (D:)
    mkyllptaaagllllaaqpamaqvqlqesggglvqaggslrlscaasgiwfsinnmawyr
    qtpgkqreriaiitsagttnyvdsvkgrftisrddakntmylqmnslipedtavyycnlv
    adydmgfqsfwgrgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cdgD (D:)
    qvqlqesggglvqaggslrlscaasgiwfsinnmawyrqtpgkqreriaiitsagttnyv
    dsvkgrftisrddakntmylqmnslipedtavyycnlvadydmgfqsfwgrgtqvtvssh
    hh