PDB entry 4cd5

View 4cd5 on RCSB PDB site
Description: The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm
Class: hydrolase
Keywords: hydrolase, beta-mannosidase, mannosidase, glycoside hydrolase, gh26, gh113, cazy, enzyme-carbohydrate interaction, mannose, glycosidase inhibition, quantum mechanics, biocatalysis, conformation
Deposited on 2013-10-30, released 2014-04-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.15273
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta mannanase, putative, man26c
    Species: Cellvibrio japonicus [TaxId:498211]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4cd5a_
  • Heterogens: NA, BMA, MVL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cd5A (A:)
    mstssislslmaalmlsaglllgcsekpaesaaavadsatttapqsgkpetalpalidtq
    ataetralyrnlaklrykhllfghedslaygvhwegdmdrsdvrdvtganpavygwelgg
    lelghtanldavnfekmqhwikagysrggvitiswhvfnpvsggnswdktpavhelipgg
    arhatlkayldtfvafnegladvdaqgnkhyppiifrpwhehngdwfwwgkghaseqdyi
    alwrftvhylrdekklrnliyayspdrsridmanfeagylygypgdayvdiigldnywdv
    gheantasadeqkaaltaslkqlvqiarskgkiaaltetgnnrltidnfwterllgpisa
    dadaseiayvmvwrnanlarekseqffapfpgqataddfkrfyqsevvlfedelpplyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cd5A (A:)
    lpalidtqataetralyrnlaklrykhllfghedslaygvhwegdmdrsdvrdvtganpa
    vygwelgglelghtanldavnfekmqhwikagysrggvitiswhvfnpvsggnswdktpa
    vhelipggarhatlkayldtfvafnegladvdaqgnkhyppiifrpwhehngdwfwwgkg
    haseqdyialwrftvhylrdekklrnliyayspdrsridmanfeagylygypgdayvdii
    gldnywdvgheantasadeqkaaltaslkqlvqiarskgkiaaltetgnnrltidnfwte
    rllgpisadadaseiayvmvwrnanlarekseqffapfpgqataddfkrfyqsevvlfed
    elpplyr