PDB entry 4cbb

View 4cbb on RCSB PDB site
Description: APO FORM OF BETAINE ALDEHYDE DEHYDROGENASE FROM Pseudomonas aeruginosa
Class: oxidoreductase
Keywords: oxidoreductase, aldehyde oxidation
Deposited on 2013-10-11, released 2014-10-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1488
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cbba_
  • Chain 'B':
    Compound: betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cbbb_
  • Chain 'C':
    Compound: betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cbbc_
  • Chain 'D':
    Compound: betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cbbd_
  • Chain 'E':
    Compound: betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cbbe_
  • Chain 'F':
    Compound: betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cbbf_
  • Chain 'G':
    Compound: betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cbbg_
  • Chain 'H':
    Compound: betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cbbh_
  • Heterogens: DTT, EDO, PE4, GOL, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cbbA (A:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cbbB (B:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cbbC (C:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cbbD (D:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cbbE (E:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cbbF (F:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cbbG (G:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cbbH (H:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf