PDB entry 4caz

View 4caz on RCSB PDB site
Description: CRYSTAL STRUCTURE OF BETAINE ALDEHYDE DEHYDROGENASE FROM Pseudomonas aeruginosa IN COMPLEX WITH NADH
Class: oxidoreductase
Keywords: aldehyde oxidation, nadh complex, oxidoreductase
Deposited on 2013-10-09, released 2014-10-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.1412
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4caza_
  • Chain 'B':
    Compound: betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cazb_
  • Heterogens: EDO, PE4, K, GOL, TXE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cazA (A:)
    marfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvw
    aamtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglv
    paiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsev
    tpltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmas
    asssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqa
    rfeakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtd
    gafgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvv
    tqdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvq
    velgdyasvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cazA (A:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cazB (B:)
    marfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvw
    aamtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglv
    paiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsev
    tpltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmas
    asssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqa
    rfeakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtd
    gafgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvv
    tqdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvq
    velgdyasvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cazB (B:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf