PDB entry 4ca6

View 4ca6 on RCSB PDB site
Description: Human Angiotensin converting enzyme N-domain in complex with a phosphinic tripeptide FI
Class: hydrolase
Keywords: hydrolase, zinc metallopeptidase, inhibitor binding
Deposited on 2013-10-07, released 2013-12-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.18855
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiotensin-converting enzyme n-domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12821 (0-609)
      • conflict (8)
      • conflict (24)
      • conflict (81)
      • conflict (116)
      • conflict (288)
      • engineered mutation (544)
      • engineered mutation (575)
    Domains in SCOPe 2.04: d4ca6a_
  • Chain 'B':
    Compound: angiotensin-converting enzyme n-domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12821 (0-609)
      • conflict (8)
      • conflict (24)
      • conflict (81)
      • conflict (116)
      • conflict (288)
      • engineered mutation (544)
      • engineered mutation (575)
    Domains in SCOPe 2.04: d4ca6b_
  • Heterogens: ZN, CL, PEG, PG4, 3EF, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ca6A (A:)
    ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
    iystakvclpnktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedfta
    lsneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdr
    yinlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeef
    ftslelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvh
    hemghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtes
    dinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrn
    ethfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagakl
    rkvlragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwh
    pplpdnypeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ca6A (A:)
    ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
    iystakvclktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedftals
    neaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdryi
    nlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeefft
    slelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvhhe
    mghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtesdi
    nyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrnet
    hfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagaklrk
    vlragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwhpp
    lpdnypeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ca6B (B:)
    ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
    iystakvclpnktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedfta
    lsneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdr
    yinlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeef
    ftslelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvh
    hemghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtes
    dinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrn
    ethfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagakl
    rkvlragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwh
    pplpdnypeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ca6B (B:)
    ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
    iystakvclptatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedftals
    neaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdryi
    nlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeefft
    slelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvhhe
    mghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtesdi
    nyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrnet
    hfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagaklrk
    vlragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwhpp
    lpdnypeg