PDB entry 4c9i

View 4c9i on RCSB PDB site
Description: Crystal Structure of the Strawberry Pathogenesis-Related 10 (PR-10) Fra a 1E protein (Form B)
Class: allergen
Keywords: allergen, pyr/pyl/rcar, bet v 1, flavonoids, catechin
Deposited on 2013-10-02, released 2013-10-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.21628
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major strawberry allergen Fra a 1-E
    Species: Fragaria x ananassa [TaxId:3747]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q256S2 (3-161)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4c9ia1, d4c9ia2
  • Chain 'B':
    Compound: Major strawberry allergen Fra a 1-E
    Species: Fragaria x ananassa [TaxId:3747]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q256S2 (3-161)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4c9ib1, d4c9ib2
  • Chain 'C':
    Compound: Major strawberry allergen Fra a 1-E
    Species: Fragaria x ananassa [TaxId:3747]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q256S2 (3-161)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4c9ic1, d4c9ic2
  • Chain 'D':
    Compound: Major strawberry allergen Fra a 1-E
    Species: Fragaria x ananassa [TaxId:3747]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q256S2 (3-161)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4c9id1, d4c9id2
  • Chain 'E':
    Compound: Major strawberry allergen Fra a 1-E
    Species: Fragaria x ananassa [TaxId:3747]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q256S2 (3-161)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4c9ie1, d4c9ie2
  • Chain 'F':
    Compound: Major strawberry allergen Fra a 1-E
    Species: Fragaria x ananassa [TaxId:3747]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q256S2 (3-161)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4c9if1, d4c9if2
  • Heterogens: GOL, KXN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4c9iA (A:)
    amagvytyeneftsdipapklfkafvldadnlipkiapqavkcaeilegdggpgtikkit
    fgegshygyvkhkihsidkvnhtysysliegdalseniekidyetklvsaphggtiiktt
    skyhtkgdveikeehvkagkekaahlfkliegylkdhpseyn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4c9iB (B:)
    amagvytyeneftsdipapklfkafvldadnlipkiapqavkcaeilegdggpgtikkit
    fgegshygyvkhkihsidkvnhtysysliegdalseniekidyetklvsaphggtiiktt
    skyhtkgdveikeehvkagkekaahlfkliegylkdhpseyn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4c9iC (C:)
    amagvytyeneftsdipapklfkafvldadnlipkiapqavkcaeilegdggpgtikkit
    fgegshygyvkhkihsidkvnhtysysliegdalseniekidyetklvsaphggtiiktt
    skyhtkgdveikeehvkagkekaahlfkliegylkdhpseyn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4c9iD (D:)
    amagvytyeneftsdipapklfkafvldadnlipkiapqavkcaeilegdggpgtikkit
    fgegshygyvkhkihsidkvnhtysysliegdalseniekidyetklvsaphggtiiktt
    skyhtkgdveikeehvkagkekaahlfkliegylkdhpseyn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4c9iE (E:)
    amagvytyeneftsdipapklfkafvldadnlipkiapqavkcaeilegdggpgtikkit
    fgegshygyvkhkihsidkvnhtysysliegdalseniekidyetklvsaphggtiiktt
    skyhtkgdveikeehvkagkekaahlfkliegylkdhpseyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c9iE (E:)
    amagvytyeneftsdipapklfkafvldadnlipkiapqavkcaeilegdggpgtikkit
    fgygyvkhkihsidkvnhtysysliegdalseniekidyetklvsaphggtiikttskyh
    tkgdveikeehvkagkekaahlfkliegylkdhpseyn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4c9iF (F:)
    amagvytyeneftsdipapklfkafvldadnlipkiapqavkcaeilegdggpgtikkit
    fgegshygyvkhkihsidkvnhtysysliegdalseniekidyetklvsaphggtiiktt
    skyhtkgdveikeehvkagkekaahlfkliegylkdhpseyn