PDB entry 4c9c

View 4c9c on RCSB PDB site
Description: Crystal Structure of the Strawberry Pathogenesis-Related 10 (PR-10) Fra a 1E protein (Form A)
Class: allergen
Keywords: start, pyr/pyl/rcar, allergen, bet v 1
Deposited on 2013-10-02, released 2013-10-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.20788
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major strawberry allergen Fra a 1-E
    Species: Fragaria x ananassa [TaxId:3747]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q256S2 (3-161)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4c9ca1, d4c9ca2
  • Chain 'B':
    Compound: Major strawberry allergen Fra a 1-E
    Species: Fragaria x ananassa [TaxId:3747]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q256S2 (3-161)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4c9cb1, d4c9cb2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c9cA (A:)
    amagvytyeneftsdipapklfkafvldadnlipkiapqavkcaeilegdggpgtikkit
    fgegshygyvkhkihsidkvnhtysysliegdalseniekidyetklvsaphggtiiktt
    skyhtkgdveikeehvkagkekaahlfkliegylkdhpseyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c9cA (A:)
    amagvytyeneftsdipapklfkafvldadnlipkiapqavkcaeilegdggpgtikkit
    fgygyvkhkihsidkvnhtysysliegdalseniekidyetklvsaphggtiikttskyh
    tkgdveikeehvkagkekaahlfkliegylkdhpseyn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4c9cB (B:)
    amagvytyeneftsdipapklfkafvldadnlipkiapqavkcaeilegdggpgtikkit
    fgegshygyvkhkihsidkvnhtysysliegdalseniekidyetklvsaphggtiiktt
    skyhtkgdveikeehvkagkekaahlfkliegylkdhpseyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c9cB (B:)
    amagvytyeneftsdipapklfkafvldadnlipkiapqavkcaeilegdggpgtikkit
    fggyvkhkihsidkvnhtysysliegdalseniekidyetklvsaphggtiikttskyht
    kgdveikeehvkagkekaahlfkliegylkdhpseyn