PDB entry 4c94

View 4c94 on RCSB PDB site
Description: Crystal Structure of the Strawberry Pathogenesis-Related 10 (PR-10) Fra a 3 protein in complex with Catechin
Class: allergen
Keywords: allergen, pyr/pyl/rcar, bet v 1, flavonoids
Deposited on 2013-10-02, released 2013-10-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.17861
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fra a 3 allergen
    Species: Fragaria x ananassa [TaxId:3747]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0E0C7 (3-160)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4c94a1, d4c94a2
  • Chain 'B':
    Compound: fra a 3 allergen
    Species: Fragaria x ananassa [TaxId:3747]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0E0C7 (3-160)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4c94b1, d4c94b2
  • Chain 'C':
    Compound: fra a 3 allergen
    Species: Fragaria x ananassa [TaxId:3747]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0E0C7 (3-160)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4c94c1, d4c94c2
  • Chain 'D':
    Compound: fra a 3 allergen
    Species: Fragaria x ananassa [TaxId:3747]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0E0C7 (3-160)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4c94d1, d4c94d2
  • Chain 'E':
    Compound: fra a 3 allergen
    Species: Fragaria x ananassa [TaxId:3747]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0E0C7 (3-160)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4c94e1, d4c94e2
  • Heterogens: KXN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4c94A (A:)
    amagvftyeseftsvipppklfkafvldadnlipkiapqavksaeiiegdggvgtikkih
    lgegseysyvkhkidgidkdnfvysysiiegdaigdkiekisyeiklvasgggsiiksts
    hyhtkgeveikeehvkagkeraaglfkiienhllahpeeyn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4c94B (B:)
    amagvftyeseftsvipppklfkafvldadnlipkiapqavksaeiiegdggvgtikkih
    lgegseysyvkhkidgidkdnfvysysiiegdaigdkiekisyeiklvasgggsiiksts
    hyhtkgeveikeehvkagkeraaglfkiienhllahpeeyn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4c94C (C:)
    amagvftyeseftsvipppklfkafvldadnlipkiapqavksaeiiegdggvgtikkih
    lgegseysyvkhkidgidkdnfvysysiiegdaigdkiekisyeiklvasgggsiiksts
    hyhtkgeveikeehvkagkeraaglfkiienhllahpeeyn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4c94D (D:)
    amagvftyeseftsvipppklfkafvldadnlipkiapqavksaeiiegdggvgtikkih
    lgegseysyvkhkidgidkdnfvysysiiegdaigdkiekisyeiklvasgggsiiksts
    hyhtkgeveikeehvkagkeraaglfkiienhllahpeeyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c94D (D:)
    amagvftyeseftsvipppklfkafvldadnlipkiapqavksaeiiegdggvgtikkih
    lgsyvkhkidgidkdnfvysysiiegdaigdkiekisyeiklvasgggsiikstshyhtk
    geveikeehvkagkeraaglfkiienhllahpeeyn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4c94E (E:)
    amagvftyeseftsvipppklfkafvldadnlipkiapqavksaeiiegdggvgtikkih
    lgegseysyvkhkidgidkdnfvysysiiegdaigdkiekisyeiklvasgggsiiksts
    hyhtkgeveikeehvkagkeraaglfkiienhllahpeeyn