PDB entry 4c92

View 4c92 on RCSB PDB site
Description: Crystal structure of the yeast Lsm1-7 complex
Class: transcription
Keywords: transcription, lsm1-7, decapping activators, mRNA degradation
Deposited on 2013-10-02, released 2013-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2133
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sm-like protein lsm1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: u6 snrna-associated sm-like protein lsm2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38203 (11-104)
      • expression tag (0-10)
    Domains in SCOPe 2.07: d4c92b1, d4c92b2
  • Chain 'C':
    Compound: U6 snRNA-associated Sm-like protein LSm3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c92c_
  • Chain 'D':
    Compound: u6 snrna-associated sm-like protein lsm4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c92d_
  • Chain 'E':
    Compound: U6 snRNA-associated Sm-like protein LSm5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c92e_
  • Chain 'F':
    Compound: U6 snRNA-associated Sm-like protein LSm6
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c92f_
  • Chain 'G':
    Compound: U6 snRNA-associated Sm-like protein LSm7
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c92g_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4c92B (B:)
    senlyfqgsgslffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisctdekk
    yphlgsvrnifirgstvryvylnknmvdtnllqdatrrevmterk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4c92C (C:)
    metpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnneelsese
    rrcemvfirgdtvtlistpsedddgavei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c92C (C:)
    metpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnneelsese
    rrcemvfirgdtvtlistp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4c92D (D:)
    mlplylltnakgqqmqielkngeiiqgiltnvdnwmnltlsnvteyseesainsednaes
    skavklneiyirgtfikfiklqdniidkvkqqinsnnnsnsngpghkryynnrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c92D (D:)
    mlplylltnakgqqmqielkngeiiqgiltnvdnwmnltlsnvteyseesainsednaes
    skavklneiyirgtfikfiklqdn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4c92E (E:)
    mslpeilplevidktinqkvlivlqsnrefegtlvgfddfvnviledavewlidpedesr
    nekvmqhhgrmllsgnniailvpggkktpteal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c92E (E:)
    peilplevidktinqkvlivlqsnrefegtlvgfddfvnviledavewlidpedesrnek
    vmqhhgrmllsgnniailvpggkk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4c92F (F:)
    msgkastegsvtteflsdiigktvnvklasgllysgrlesidgfmnvalssatehyesnn
    nkllnkfnsdvflrgtqvmyiseqki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c92F (F:)
    svtteflsdiigktvnvklasgllysgrlesidgfmnvalssatehyesnnnkllnkfns
    dvflrgtqvmyiseqki
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4c92G (G:)
    mhqqhsksenkpqqqrkkfegpkreaildlakykdskirvklmggklvigvlkgydqlmn
    lvlddtveymsnpddenntelisknarklgltvirgtilvslssaegsdvlymqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c92G (G:)
    aildlakykdskirvklmggklvigvlkgydqlmnlvlddtveymsisknarklgltvir
    gtilvslssaegsdv