PDB entry 4c7q

View 4c7q on RCSB PDB site
Description: Solution structure of the Nt. GR-RBP1 RRM domain
Class: RNA binding protein
Keywords: RNA binding protein
Deposited on 2013-09-24, released 2013-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding glycine-rich protein
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D6PZY5 (1-85)
      • expression tag (0)
    Domains in SCOPe 2.07: d4c7qa1, d4c7qa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4c7qA (A:)
    gmaeveyrcfvgglawattdqtlgeafsqfgeildskiindretgrsrgfgfvtfkdeka
    mrdaiegmngqdldgrnitvneaqsr