PDB entry 4c6v

View 4c6v on RCSB PDB site
Description: Crystal structure of M. tuberculosis KasA in complex with TLM5 (Soak for 5 min)
Class: transferase
Keywords: transferase, kas enzyme, type 2 fatty acid biosynthesis, mycolic acid synthesis, thiolactomycin
Deposited on 2013-09-19, released 2013-10-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.17969
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 1
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4c6va1, d4c6va2
  • Heterogens: EDO, K, TLG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c6vA (A:)
    mgsshhhhhhssglvprgshmasmsqpstanggfpsvvvtavtattsispdiestwkgll
    agesgihaledefvtkwdlavkigghlkdpvdshmgrldmrrmsyvqrmgkllggqlwes
    agspevdpdrfavvvgtglggaerivesydlmnaggprkvsplavqmimpngaaaviglq
    lgaragvmtpvsacssgseaiahawrqivmgdadvavcggvegpiealpiaafsmmrams
    trndeperasrpfdkdrdgfvfgeagalmlieteehakargakplarllgagitsdafhm
    vapaadgvragramtrslelaglspadidhvnahgtatpigdaaeanairvagcdqaavy
    apksalghsigavgalesvltvltlrdgvipptlnyetpdpeidldvvageprygdyrya
    vnnsfgfgghnvalafgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c6vA (A:)
    sqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavkig
    ghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggaer
    ivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsacssgseaiaha
    wrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfge
    agalmlieteehakargakplarllgagitsdafhmvapaadgvragramtrslelagls
    padidhvnahgtatpigdaaeanairvagcdqaavyapksalghsigavgalesvltvlt
    lrdgvipptlnyetpdpeidldvvageprygdyryavnnsfgfgghnvalafgry